DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:64/147 - (43%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVMGLRTNNAIVIG---VEKRSVGDLQEERMVRKICMLDDHVVMTFSGLTAD----ARILVSRAQ 90
            |::|::..:.|::.   :..:|...|.:|  |||...:.|:.:|:.:|...|    :..::....
  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDE--VRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMD 65

  Fly    91 MEAQSHRLNFEKPTTVEYITRYI-AQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSGI 154
            :...::..:......|.:|.|:: |.||.:.|       |.:|.||||:|....|.|...|..| 
  Fly    66 LYKITNGYDLTVRGAVHFIRRHLSAYLKSDCT-------FQVSLLVGGYDLTSGPELHYIDYLG- 122

  Fly   155 FYEWRANTTGRSSQPVR 171
                       :|.|||
  Fly   123 -----------NSVPVR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 35/147 (24%)
Ntn_hydrolase 5..214 CDD:294319 35/147 (24%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 35/147 (24%)
proteasome_beta_type_2 1..193 CDD:239727 35/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.