DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:214 Identity:42/214 - (19%)
Similarity:86/214 - (40%) Gaps:36/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRAVTIYSPDGHLLQVEYAQEAVRR-------------GSTVMGLRTNNAIVIGVEKRSV-GDLQ 56
            |..:.|.:|     ..|..:|:|::             |:|.:|......|::.|:.|:. |.|.
  Fly    38 DNPLAIMAP-----PYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLI 97

  Fly    57 EERMVRKICMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYT 121
            ..:.:.|:..::.:::.|.:|..||..........|.:.|.|.:::...|:...:||:.:...| 
  Fly    98 GSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEY- 161

  Fly   122 QSNGRRPFGL--SCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTI 184
                 :..||  ..::.|:..:| |.|...|.:|:....:....|..:......::  :|..|.:
  Fly   162 -----KGMGLCMGMMLAGWSPEG-PSLVYVDSNGLRIHGKLFAVGSGAPNALGILD--SDYRLDL 218

  Fly   185 ADEAA------AIKHIVRT 197
            :|..|      |:.|...|
  Fly   219 SDNEAYDLAFLAVYHATMT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 42/214 (20%)
Ntn_hydrolase 5..214 CDD:294319 42/214 (20%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 40/206 (19%)
proteasome_beta_type_5 72..259 CDD:239730 35/175 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.