DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psma7

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001008218.1 Gene:Psma7 / 29674 RGDID:61851 Length:248 Species:Rattus norvegicus


Alignment Length:247 Identity:133/247 - (53%)
Similarity:184/247 - (74%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||||:|::||||||.|||||||||::|||.:|:|..:.:|:||||:||..||:||.|||||.|||
  Rat     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDD 67

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            :|.|.|:||||||||:::||::|.|||||..|.|.||||||||||.|||.|||||||||||:|.|
  Rat    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   135 VGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEK-HADEILTIADEAAAIKHIVRTL 198
            :.|||.||||.|:||||||.::.|:||..||.::.||:::|| :.|:.:...|  ..||.:::.|
  Rat   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDD--LTIKLVIKAL 195

  Fly   199 VSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIEDEAEASRRPR 250
            :.|.......:|:||::..|||:::..:   ::|:.| .|||.|.|.:.:.:
  Rat   196 LEVVQSGGKNIELAVMRRDQPLKILSPE---EIEKYV-AEIEKEKEENEKKK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 123/210 (59%)
Ntn_hydrolase 5..214 CDD:294319 122/209 (58%)
Psma7NP_001008218.1 PRK03996 1..230 CDD:235192 128/232 (55%)
proteasome_alpha_type_7 3..211 CDD:239724 122/209 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11582
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.