DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psma3

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:248 Identity:76/248 - (30%)
Similarity:128/248 - (51%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||.:.:.:||||.:.|||||.:||...||.:|:|..:.:|.||||..:..|.||...:::..:|.
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            ||.|..:||.||||.|...|:.||.:.|.||.....::::...:|.....||..:..||||.|.:
  Rat    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   135 VGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIAD---EAAAIKHIVR 196
            :|.:..:....|:..||||:.|.:.....|::.|..:..:||...:.:|..|   |.|.|.:||.
  Rat   138 LGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVH 202

  Fly   197 TLVSVSSLNHTQMEVA----VLKYRQPLRMIDHQVLADLERTVRREIEDEAEA 245
            ..|...:.   ::|::    :.|.|.  .::...|..:.|:..:..:::|.|:
  Rat   203 DEVKDKAF---ELELSWVGELTKGRH--EIVPKDVREEAEKYAKESLKEEDES 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 70/216 (32%)
Ntn_hydrolase 5..214 CDD:294319 70/215 (33%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.