DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psma1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus


Alignment Length:237 Identity:82/237 - (34%)
Similarity:129/237 - (54%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :||..||::||.|.:.|:|||.|||::||..:||::....|:...||:..:|...:  :||..:|
  Rat     5 QYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ--KKILHVD 67

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            :|:.::.:|||||||:|.:..:.|....|..|::|..|..:...|....|..||..||||:|:..
  Rat    68 NHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGL 132

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTI-ADEAAAIKHIVR- 196
            |:.|:|:.| ||:|||.||..:::.||.:.|..||..|.|:|:|..|.:.. .||  .:||.:| 
  Rat   133 LIAGYDDMG-PHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDE--LVKHGLRA 194

  Fly   197 ---TLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTV 235
               ||.:...|....:.:.:             |..|||.|:
  Rat   195 LRETLPAEQDLTTKNVSIGI-------------VGKDLEFTI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 77/214 (36%)
Ntn_hydrolase 5..214 CDD:294319 77/213 (36%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 77/227 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.