DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psmb5

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:140 Identity:27/140 - (19%)
Similarity:62/140 - (44%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTVMGLRTNNAIVIGVEKR-SVGDLQEERMVRKICMLDDHVVMTFSGLTADARILVSRAQMEAQ 94
            |:|.:..:..:.:::..:.| :.|.....:.|:|:..::.:::.|.:|..||..........:.:
  Rat    59 GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR 123

  Fly    95 SHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLS--CLVGGFDEDGTPHLFQTDPSGIFYE 157
            .:.|..::..:|...::.:|.:...|      :..|||  .::.|:|:.| |.|:..|..|....
  Rat   124 IYELRNKERISVAAASKLLANMVYQY------KGMGLSMGTMICGWDKRG-PGLYYVDSEGNRIS 181

  Fly   158 WRANTTGRSS 167
            ..|.:.|..|
  Rat   182 GTAFSVGSGS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 27/140 (19%)
Ntn_hydrolase 5..214 CDD:294319 27/140 (19%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 27/140 (19%)
proteasome_beta_type_5 60..247 CDD:239730 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.