DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psma7

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_036099.1 Gene:Psma7 / 26444 MGIID:1347070 Length:248 Species:Mus musculus


Alignment Length:247 Identity:133/247 - (53%)
Similarity:185/247 - (74%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||||:|::||||||.|||||||||::|||.:|:|..:.:|:||||:||..||:||.|||||.|||
Mouse     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDD 67

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            :|.|.|:||||||||:::||::|.|||||..|.|.||||||||||.|||.|||||||||||:|.|
Mouse    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   135 VGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEK-HADEILTIADEAAAIKHIVRTL 198
            :.|||.||||.|:||||||.::.|:||..||.::.||:::|| :.|:.:...|  ..||.:::.|
Mouse   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDD--LTIKLVIKAL 195

  Fly   199 VSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIEDEAEASRRPR 250
            :.|.......:|:||::..|||::::.:   ::|:.| .|||.|.|.:.:.:
Mouse   196 LEVVQSGGKNIELAVMRRDQPLKILNPE---EIEKYV-AEIEKEKEENEKKK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 123/210 (59%)
Ntn_hydrolase 5..214 CDD:294319 122/209 (58%)
Psma7NP_036099.1 proteasome_alpha_type_7 3..211 CDD:239724 122/209 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11844
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S208
OMA 1 1.010 - - QHG62217
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.