DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and pre6

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_595165.1 Gene:pre6 / 2540175 PomBaseID:SPBC106.16 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:115/247 - (46%)
Similarity:170/247 - (68%) Gaps:10/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||||::::||||.||||||.|||||||:|.:.||.|..||||||:::|..||.....:||.|:|:
pombe     4 YDRALSVFSPDGRLLQVEYGQEAVRRGTTAIALRGNECIVIGVERKNVPKLQNVSNFQKIAMVDN 68

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            ||.:.|:||.||||||:.:|::|||:|:||...|.::||:|||:|.::|.||||.|.||||:|.|
pombe    69 HVCLAFAGLNADARILIDKARVEAQNHKLNLADPVSIEYLTRYVAGVQQKYTQSGGVRPFGVSTL 133

  Fly   135 VGGFD-EDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTL 198
            :.||| .|.||.::||:|:||:..|:|...||:|:..|:|:||:..|.|: .||  .|...|.:|
pombe   134 IAGFDVGDNTPRVYQTEPAGIYNAWKATAIGRASKAAREYLEKNWKEGLS-RDE--TIHLAVSSL 195

  Fly   199 VSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIED--EAEASRR 248
            :.|.......:|:|::...:.:..:.    :|...|:.:||:|  ||||:|:
pombe   196 LEVVQTASGNIELAIMDPGKDVEFLH----SDKIDTIVKEIQDEKEAEAARK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 105/210 (50%)
Ntn_hydrolase 5..214 CDD:294319 105/209 (50%)
pre6NP_595165.1 PRK03996 1..232 CDD:235192 107/234 (46%)
proteasome_alpha_type_7 4..211 CDD:239724 105/209 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I650
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I730
OMA 1 1.010 - - QHG62217
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - otm47071
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.