DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and CG30382

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:241 Identity:68/241 - (28%)
Similarity:120/241 - (49%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAV-RRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :||.:||:||:|.|.|||||.:|: :...|.:.|::.:..|:..:|:..........|..:..:.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            ..:....:|..||:|..|.:|:.||.:.|..:.....|:.:.|.||.:.|.|||:...||.|.|.
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTL 198
            ::..:|.:..|.:::|||:|.|..::|.:.|..:.....|:||.....|:   |..||:..:..|
  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLS---EEKAIQLAISCL 200

  Fly   199 VSVSSLNH--TQMEVAVLKYRQP-LRMIDHQVLADLERTVRREIED 241
            .||.:::.  ..:|:.|:....| .|::|           .||||:
  Fly   201 SSVLAIDFKPNGIEIGVVSKSDPTFRILD-----------EREIEE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 61/212 (29%)
Ntn_hydrolase 5..214 CDD:294319 60/211 (28%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 68/241 (28%)
proteasome_alpha_type_6 8..218 CDD:239723 60/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441022
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.