DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psmb7

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:238 Identity:51/238 - (21%)
Similarity:96/238 - (40%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVTIYSPD-----------GHLLQVEYAQ------EAVRRGSTVMGLRTNNAIVIGVEKRSV-GD 54
            ||:::.|.           ..:|:.::|:      :|.:.|:|:.|:...:.||:|.:.|:. |.
Mouse     3 AVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGM 67

  Fly    55 LQEERMVRKICMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQN 119
            :..::...||..:..::....:|..||..:.........:.|.|...:...|....|.:.|:...
Mouse    68 VVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFR 132

  Fly   120 YTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSS--------QPVRDYMEK 176
            |     :...|.:.::||.|..| |||:...|.|...:....|.|..|        ...|..||:
Mouse   133 Y-----QGYIGAALVLGGVDVTG-PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEE 191

  Fly   177 HADEILTIADEAAAIKHIVRTLVSVSSLNHTQMEVAVLKYRQP 219
              :|...:..||.| ..|...|.|.|:::...:..:.|.:.:|
Mouse   192 --EEAKKLVSEAIA-AGIFNDLGSGSNIDLCVISKSKLDFLRP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 49/232 (21%)
Ntn_hydrolase 5..214 CDD:294319 49/231 (21%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 43/192 (22%)
proteasome_beta_type_7 44..232 CDD:239732 44/197 (22%)
Pr_beta_C 236..271 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.