DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and pas-2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_505750.1 Gene:pas-2 / 179493 WormBaseID:WBGene00003923 Length:231 Species:Caenorhabditis elegans


Alignment Length:229 Identity:78/229 - (34%)
Similarity:123/229 - (53%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKIC 65
            |...|..::|.:||.|.|:|:|||..||:.|...:|||..:.:|:..|  :||.:..:.. .|:.
 Worm     1 MGDHYGFSLTTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLATE--NVGSVLTDDQ-PKVE 62

  Fly    66 MLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNF-EKPTTVEYITRYIAQLKQNYTQSNGRRPF 129
            .:..|:...:||:..|.||||.:|:..|..:.:.: |:..|::.:|. ||.:.|.||||.|.|||
 Worm    63 QISKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTD-IAAVMQEYTQSGGVRPF 126

  Fly   130 GLSCLVGGFDED-GTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKH 193
            |.|.|:.|:|:: |.|.|||.||||.::.|:|...|::....:.::||...|.|.:.|.......
 Worm   127 GASLLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFSEALELDDGIHTALL 191

  Fly   194 IVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQV 227
            .:|....| .:|...:||||.......|:...||
 Worm   192 TLRESFDV-GMNENNVEVAVCNSTGFHRLTKQQV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 74/211 (35%)
Ntn_hydrolase 5..214 CDD:294319 73/210 (35%)
pas-2NP_505750.1 proteasome_alpha_type_2 5..229 CDD:239719 77/225 (34%)
PRK03996 10..228 CDD:235192 76/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.