DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and pbs-6

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:173 Identity:37/173 - (21%)
Similarity:65/173 - (37%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVE------YAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQ-EERMVRKICMLDDHVVMTFSG 77
            |:|      |:.|.   |||......|.|||....:.:..|:. ..|...||.:|:|::::|.||
 Worm    38 QIERQRWNPYSMEG---GSTCAISGENFAIVASDTRMTQNDINILTRDAEKIQILNDNIILTTSG 99

  Fly    78 LTADARILVSRAQMEAQSHRLNFEKPTTVE----------YITRYIAQLKQNYTQSNGRRPFGLS 132
            ...|...|....|.....:|.::....:|:          |..|:.              |:...
 Worm   100 FYGDVLQLKKVLQSRLHKYRFDYRSDMSVDLCAELLSRNLYYRRFF--------------PYYTG 150

  Fly   133 CLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYME 175
            .::.|.||.|...:|..||.|.......:.:|.:...:..:::
 Worm   151 AILAGIDEHGKGAVFSYDPIGCIERLGYSASGAAEPMIIPFLD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 37/173 (21%)
Ntn_hydrolase 5..214 CDD:294319 37/173 (21%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 37/173 (21%)
Ntn_hydrolase 44..258 CDD:294319 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.