DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and pas-7

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_496177.2 Gene:pas-7 / 174571 WormBaseID:WBGene00003928 Length:250 Species:Caenorhabditis elegans


Alignment Length:195 Identity:57/195 - (29%)
Similarity:96/195 - (49%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||.|.:.:||||.:.||||||:||....|::.:|..|.:|:..:|.....|..:....::..::|
 Worm     8 YDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYTDNANPRMFNVND 72

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            :|.:..:|...|...|.:.|..||.....::.:|..::.|...:|:....:|.... ||||....
 Worm    73 NVGVAVAGNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYIHIHTLGIS-RPFGAGAF 136

  Fly   135 VGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTI---ADEAAAIKHIVR 196
            ...:::.....||..:|||:.||::|...|:..|..:..:||...|.|.:   ..|||.|..:||
 Worm   137 FMSWNKQTGGRLFLVEPSGLNYEYKAWAVGKHRQAAKAEIEKLKIEELDVNQLVKEAARIIMVVR 201

  Fly   197  196
             Worm   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 57/195 (29%)
Ntn_hydrolase 5..214 CDD:294319 57/195 (29%)
pas-7NP_496177.2 proteasome_alpha_type_3 5..216 CDD:239720 57/195 (29%)
PRE1 6..231 CDD:223711 57/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.