Sequence 1: | NP_001286844.1 | Gene: | Prosalpha4T2 / 37910 | FlyBaseID: | FBgn0017556 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494913.1 | Gene: | pbs-3 / 173858 | WormBaseID: | WBGene00003949 | Length: | 204 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 41/204 - (20%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 42/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 GSTVMGLRTNNAIVIGVEKRSVGDLQEERMV------RKICMLDDHVVMTFSGLTADARILVSRA 89
Fly 90 QMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFG---LSCLVGGFDEDGTPHLFQTDP 151
Fly 152 SGIF---YEWRANTTG------------RSSQPVRDYMEKHADEILTIADEAAA------IKHIV 195
Fly 196 RTLVSVSSL 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4T2 | NP_001286844.1 | arc_protsome_A | 5..215 | CDD:163366 | 41/204 (20%) |
Ntn_hydrolase | 5..214 | CDD:294319 | 41/204 (20%) | ||
pbs-3 | NP_494913.1 | PRE1 | 3..193 | CDD:223711 | 38/196 (19%) |
proteasome_beta_type_3 | 6..200 | CDD:239728 | 41/204 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |