DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and pbs-3

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans


Alignment Length:204 Identity:41/204 - (20%)
Similarity:78/204 - (38%) Gaps:42/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTVMGLRTNNAIVIGVEKRSVGDLQEERMV------RKICMLDDHVVMTFSGLTADARILVSRA 89
            |.||:.:..:..:.|..:.| :|    |:|.      :|:..:.|.|.:..:|..:|||.::.:.
 Worm     8 GGTVVAMAGDECVCIASDLR-IG----EQMTTIATDQKKVHKVTDKVYVGLAGFQSDARTVLEKI 67

  Fly    90 QMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFG---LSCLVGGFDEDGTPHLFQTDP 151
            ......:.|...:....:.::..|:.|...:.       ||   ...||.|.|:...|::...|.
 Worm    68 MFRKNLYELRENRNIKPQVLSEMISNLAYQHR-------FGSYFTEPLVAGLDDTNKPYICCMDT 125

  Fly   152 SGIF---YEWRANTTG------------RSSQPVRDYMEKHADEILTIADEAAA------IKHIV 195
            .|..   .::.|..||            |.:....:..|..|..||:..:..||      :..|.
 Worm   126 IGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAASGWGAVVYTIT 190

  Fly   196 RTLVSVSSL 204
            :..|:||::
 Worm   191 KDKVNVSTI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 41/204 (20%)
Ntn_hydrolase 5..214 CDD:294319 41/204 (20%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 38/196 (19%)
proteasome_beta_type_3 6..200 CDD:239728 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.