DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PSMA8

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 / 143471 HGNCID:22985 Length:256 Species:Homo sapiens


Alignment Length:257 Identity:136/257 - (52%)
Similarity:187/257 - (72%) Gaps:11/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKIC 65
            ||.|||||:|::||||||.|||||||||::|||.:|:|..|.:|:||||:||..||:||.|||||
Human     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKIC 65

  Fly    66 MLDDHVVMTFS------GLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSN 124
            .|||||.|.|:      |||||||::::||::|.|||:|..|.|.|||||||:||.|||.|||||
Human    66 ALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSN 130

  Fly   125 GRRPFGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAA 189
            ||||||:|.|:.|||:||...|:||||||.::.|:||..|||::.||:::||:..|. .||.::.
Human   131 GRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTED-AIASDSE 194

  Fly   190 AIKHIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIEDEAEASRRPRA 251
            |||..::.|:.|.......:|:|:::..|||:|...:   ::|..| .|||.|.|.:.:.::
Human   195 AIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAK---EVELYV-TEIEKEKEEAEKKKS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 122/215 (57%)
Ntn_hydrolase 5..214 CDD:294319 122/214 (57%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 127/235 (54%)
proteasome_alpha_type_7 5..219 CDD:239724 122/214 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11918
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.