DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and psmb11b

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:219 Identity:41/219 - (18%)
Similarity:63/219 - (28%) Gaps:84/219 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTVMGLRTNNAIVIGVEKRS--VGDLQEERMVRKICMLDDHVVMTFSGLTADA----RILVSRA 89
            |:|.:|......::...:.||  .|.:..... .|:..:..|:|.|.||.:||.    |||....
Zfish   109 GTTTLGFAFQGGVIAAADTRSSCAGKVACPAS-PKVLPIHSHLVGTTSGTSADCALWKRILAREL 172

  Fly    90 QMEAQSHRLNF--------------------------------------EKPTTVEYITRYIAQL 116
            ::....||...                                      |:|.|..|....:...
Zfish   173 RLYQLRHRRRLSTGGAAKLLSHMLHPFKGTELCVAATLCGWDGDEDQDNEQPMTERYANTTLTSK 237

  Fly   117 KQN-----------------YTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTG 164
            ..:                 |..|:|.|..|....||    .|:|:.:.....|:  .|     |
Zfish   238 SSSQSAASSGLSGVRGPRVVYVCSDGLRLQGALFSVG----SGSPYAYSILDGGV--RW-----G 291

  Fly   165 RSSQPVRDYMEKHADEILTIADEA 188
            .|:|           |...:|.||
Zfish   292 MSAQ-----------EAAAVAREA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 41/219 (19%)
Ntn_hydrolase 5..214 CDD:294319 41/219 (19%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 40/218 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.