DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KDR and Wsck

DIOPT Version :10

Sequence 1:NP_002244.1 Gene:KDR / 3791 HGNCID:6307 Length:1356 Species:Homo sapiens
Sequence 2:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster


Alignment Length:440 Identity:102/440 - (23%)
Similarity:176/440 - (40%) Gaps:127/440 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   759 EKTNLEIIILVGTAVI---AMFFWLLLVIILR----TVKRANGGE-----LKT--------GYLS 803
            ||....::.|..|.||   .:...|:....||    ..:|..||.     |:|        ||| 
  Fly   396 EKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENNGYL- 459

Human   804 IVMDPDELP------------LDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI 856
              ::.|.||            |.|..||:|.:|.       ||.:...:|.|.||::|.......
  Fly   460 --VEDDPLPHSPENFKQQLQQLVEGYERIPRNAL-------RLNVNDVIGDGRFGEIITGKVSTN 515

Human   857 DKTATCRTVAVKMLKE--GATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFC 919
            |....| |:.|..|.:  |.|.::   |:.||:.|..:....::::..|....|....::     
  Fly   516 DFARDC-TLHVLCLDDLNGTTQAQ---LLRELRQLSQLKRQEHLLDFYGVSASPDWFYLI----- 571

Human   920 KFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLS 984
                                     |.|.:       :.|||:|   ..|:..|.|     ..|:
  Fly   572 -------------------------FEQQR-------MSLKRKL---VESRLMAPS-----PRLT 596

Human   985 DVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFG- 1048
            .:.|:          |.|:    :.:::|..|.:|:|.:.:||.|.:.::.::....:|:..|| 
  Fly   597 SLSEQ----------LVLQ----WIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGP 647

Human  1049 -----LARDIYKDPDYVRKGDARLPLKWMAPETI-FDRVYTIQSDVWSFGVLLWEIFSLGASPYP 1107
                 :||   :.||:.|         |:|||.: ....::.:|||||...:.||..:||.:||.
  Fly   648 LPYMNIAR---QQPDHNR---------WLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYA 700

Human  1108 -GVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSEL 1156
             .|..:::....::...|...|.|...::||.:|:||..|||:|.:..::
  Fly   701 NAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDV 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KDRNP_002244.1 IgI_VEGFR 224..326 CDD:409448
Ig strand A 224..228 CDD:409448
Ig strand A' 234..238 CDD:409448
Ig strand B 240..249 CDD:409448
Ig strand C 256..261 CDD:409448
Ig strand C' 264..266 CDD:409448
Ig strand D 270..278 CDD:409448
Ig strand E 286..294 CDD:409448
Ig strand F 304..310 CDD:409448
Ig strand G 315..321 CDD:409448
IgI_VEGFR-2 329..417 CDD:409450
Ig strand A 329..332 CDD:409450
Ig strand A' 339..343 CDD:409450
Ig strand B 345..356 CDD:409450
Ig strand C 360..366 CDD:409450
Ig strand C' 368..371 CDD:409450
Ig strand D 376..379 CDD:409450
Ig strand E 381..386 CDD:409450
Ig strand F 394..402 CDD:409450
Ig strand G 408..417 CDD:409450
IG_like 565..661 CDD:214653
I-set 667..754 CDD:400151
Ig strand B 684..688 CDD:409353
Ig strand C 697..701 CDD:409353
Ig strand E 720..724 CDD:409353
Ig strand F 734..739 CDD:409353
VEGFR-2_TMD 759..793 CDD:375470 10/40 (25%)
PTKc_VEGFR2 826..1167 CDD:270681 76/341 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1274..1318
WsckNP_733018.1 WSC 42..115 CDD:460348
fn3 130..222 CDD:394996
PTKc 497..750 CDD:270623 74/327 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.