DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and CKB1

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_011496.3 Gene:CKB1 / 852865 SGDID:S000002987 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:77/252 - (30%)
Similarity:124/252 - (49%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFD----SQTLEVVLD-----PEFDNEDWDCAEE 69
            ||..|....|||:.|:||.|:|:|.||:|.|..:    .:.|:::||     .|.::|| |..||
Yeast    26 WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEEDED-DVVEE 89

  Fly    70 ----------------------------------KKLYGMIHARYIVSPRGIEDMRLKYERGDFG 100
                                              ::|||:||||:|::..|::.|..|::..:||
Yeast    90 DEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFG 154

  Fly   101 SCPRVFCKRQKVLPVGLHDVWDKAQVKIYCPSCNNVYIPLPHNGM-LDGAMFGTSFPHMF---FM 161
            :|||.:|...::||.||.|...|..|::|||||.::|:|.....: |:||.:|||||.:|   |.
Yeast   155 TCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFK 219

  Fly   162 QLPSLIPSPPVEKYIPRIYGFQLHKKALMPPESAESPPIKVESSVSKSPSWLRNVPN 218
            :|...:.....|.|..:::||:::.:|:..|..                .|||..|:
Yeast   220 ELEEYVERKSKESYELKVFGFRINDEAVSGPRM----------------KWLRQYPS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 70/215 (33%)
CKB1NP_011496.3 SKB2 1..278 CDD:227374 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.