DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and CKB1

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_199519.1 Gene:CKB1 / 834754 AraportID:AT5G47080 Length:287 Species:Arabidopsis thaliana


Alignment Length:189 Identity:84/189 - (44%)
Similarity:116/189 - (61%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLE----FDSQTLEVVLDPE------FDNEDWD 65
            |.|||.||..::|:||.|.|.::||||.|||.||.    :....|:::||.|      |..|..:
plant    98 DTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYEYALDLILDVESSQGEMFTEEQNE 162

  Fly    66 CAEE--KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKI 128
            ..|.  :.|||:||||||::.:|:..|..||:..|||.||||:|..|..||||..|:...:.|||
plant   163 LIESAAEMLYGLIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDLPRSSTVKI 227

  Fly   129 YCPSCNNVYIP-LPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLHK 186
            |||.|.::|.| ..:.|.:|||.|||:|||:|.|....|.|:...:.|:.|::||:|||
plant   228 YCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPAKATQNYVQRVFGFKLHK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 79/182 (43%)
CKB1NP_199519.1 CK_II_beta 100..283 CDD:395970 79/182 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.