DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and CKB4

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_181996.1 Gene:CKB4 / 819076 AraportID:AT2G44680 Length:283 Species:Arabidopsis thaliana


Alignment Length:190 Identity:84/190 - (44%)
Similarity:116/190 - (61%) Gaps:13/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLE----FDSQTLEVVLDPEFDNEDWDCAEE-- 69
            |.|||.||..::|:||.|.|..:||||.|||.||.    :....|:::||.|..|.|....|:  
plant    93 DTSWISWFCNLRGNEFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILDVESSNGDMFTEEQHE 157

  Fly    70 ------KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKI 128
                  :.|||:||.|||::.:|:..|..||:..|||.||||||..|..||||..|:...:.|||
plant   158 MVESAAEMLYGLIHVRYILTTKGMAAMMEKYKNYDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKI 222

  Fly   129 YCPSCNNVYIP-LPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLHKK 187
            |||.|.::|.| ..:.|.:|||.|||:|||:|.|...::.|..|.:.|:|:|:||::|.|
plant   223 YCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMAYGNMKPQKPAQNYVPKIFGFKVHNK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 80/182 (44%)
CKB4NP_181996.1 CK_II_beta 95..278 CDD:395970 80/182 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.