DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and Csnk2b

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006256143.1 Gene:Csnk2b / 81650 RGDID:619978 Length:235 Species:Rattus norvegicus


Alignment Length:224 Identity:102/224 - (45%)
Similarity:135/224 - (60%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCPRSIEI-----PDGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFD----SQTLEVVLD 56
            |:.|.|.:|     .:.|||.||.|::|:||.|.|..:|||||||||||...    .|.|:::||
  Rat    11 MAGPTSADIKMSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILD 75

  Fly    57 PEFDNE------DWDCAEE--KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVL 113
            .|.|.|      ..|..|:  :.|||:||||||::.|||..|..||::||||.||||:|:.|.:|
  Rat    76 LEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML 140

  Fly   114 PVGLHDVWDKAQVKIYCPSCNNVYIPLP---HNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKY 175
            |:||.|:..:|.||:|||.|.:||.|..   |:  .|||.|||.||||.||..|...|..|..::
  Rat   141 PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHH--TDGAYFGTGFPHMLFMVHPEYRPKRPANQF 203

  Fly   176 IPRIYGFQLHKKALMPPESAES---PPIK 201
            :||:|||::|..|......|.|   .|:|
  Rat   204 VPRLYGFKIHPMAYQLQLQAASNFKSPVK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 91/184 (49%)
Csnk2bXP_006256143.1 CK_II_beta 28..211 CDD:198153 91/184 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.