DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and CkIIbeta2

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster


Alignment Length:217 Identity:98/217 - (45%)
Similarity:131/217 - (60%) Gaps:30/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFDSQ----TLEVVLD------------PEF 59
            :.|||.||...:|:||.|.|..|||||||||..|:.:.:    .|||:||            ||.
  Fly     6 ESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPAEPEL 70

  Fly    60 DNEDWDCAEEKKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKA 124
            :      |..:||||:||||:|::.||||.|..||.:|:||:|||.||..|.|||:||.|...:.
  Fly    71 E------ASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGED 129

  Fly   125 QVKIYCPSCNNVYIP-LPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLHKKA 188
            .|:||||.||:|||| ...:..||||.|||.|||||||:.|...|....:|::||:|||::|..|
  Fly   130 MVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPTA 194

  Fly   189 LMPPESAESPPIKVESSVSKSP 210
            ..  .:||     ::..|:.:|
  Fly   195 YR--TAAE-----IQKDVTMTP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 91/186 (49%)
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 90/185 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.