DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and ckb1

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001342935.1 Gene:ckb1 / 2542564 PomBaseID:SPAC1851.03 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:98/210 - (46%)
Similarity:127/210 - (60%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFD----SQTLEV---VLDPEFDNEDWDCAE--E 69
            |:|||||:||:||.|.|..::|||:||||||..:    ||:|::   ||||:...|..|..|  .
pombe    16 WVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPDLPEEVQDEVEASA 80

  Fly    70 KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYCPSCN 134
            :.|||:||||||::.:|:..|..||::.|||.||||.|..|.:|||||.|:.....||:|||.|.
pombe    81 RHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAHTKSVKLYCPRCE 145

  Fly   135 NVYIP-LPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLH------------- 185
            :||.| ...:..:|||.||||||||.|...|.|......|:|||||:||::|             
pombe   146 DVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAVPKSQERYIPRIFGFKVHSYSATFKKQDVYK 210

  Fly   186 ---KKALMPPESAES 197
               ||.|...| |||
pombe   211 EKQKKRLQGAE-AES 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 89/178 (50%)
ckb1NP_001342935.1 SKB2 16..231 CDD:227374 98/210 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.