DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and SPBC2G5.02c

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_596063.1 Gene:SPBC2G5.02c / 2540306 PomBaseID:SPBC2G5.02c Length:254 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:86/219 - (39%)
Similarity:115/219 - (52%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLE----FDSQTLEVVLD---PE-FDNEDWDCAEE 69
            |||.||....|.|:...|..::|:|.||||||.    |.::.|:::||   |: .:|.|.|..|.
pombe    40 SWISWFCSRPGREYFVEVKEDFIEDLFNLTGLNLAVPFYNEALDLILDRTAPDTLENFDMDVIET 104

  Fly    70 KK--LYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYCPS 132
            ..  |||:||.|||::..|:..|..||..|.||.||||.|....|||.||.|:..|..|.::||:
pombe   105 SAQILYGLIHQRYIITRTGLHQMAEKYSMGIFGCCPRVNCCYTHVLPAGLSDIVGKMPVMLFCPN 169

  Fly   133 CNNVYIPLPHN-GMLDGAMFGTSFPHMFFMQLPSLIP--SPPVEK-YIPRIYGFQLHKKALMPPE 193
            |.::|.|.... ..:||:.||.:|||:||...|.|.|  |.|..| |.||||||::         
pombe   170 CLDLYAPSSSRYKNIDGSFFGATFPHLFFESYPELNPKRSIPCGKIYQPRIYGFKV--------- 225

  Fly   194 SAESPPIKVESSVSKS---PSWLR 214
                      |.:||:   ..|||
pombe   226 ----------SELSKTGPRMQWLR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 79/183 (43%)
SPBC2G5.02cNP_596063.1 SKB2 14..242 CDD:227374 86/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.