DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and kin-10

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001379151.1 Gene:kin-10 / 172610 WormBaseID:WBGene00002196 Length:235 Species:Caenorhabditis elegans


Alignment Length:189 Identity:93/189 - (49%)
Similarity:124/189 - (65%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFD----SQTLEVVLD--PEFDNED----WDCA 67
            |||.||.|::|:||.|.|..|||||:||||||...    .|.|:::||  ||.|.||    .|..
 Worm     8 SWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPEDDIEDNATNTDLV 72

  Fly    68 EE--KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYC 130
            |:  :.|||:||||||::.|||..|..|:...|||.||||:|:.|.:||:||.||..:|.||:||
 Worm    73 EQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPGEAMVKLYC 137

  Fly   131 PSCNNVYIP-LPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLHKKA 188
            |.||:|::| ...:...||:.|||.||||.|...|.|.|..||.:::|::|||::|..|
 Worm   138 PRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLYGFKIHPVA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 90/182 (49%)
kin-10NP_001379151.1 CK_II_beta 8..191 CDD:198153 90/182 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.