DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl and Csnk2b

DIOPT Version :9

Sequence 1:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001290405.1 Gene:Csnk2b / 13001 MGIID:88548 Length:257 Species:Mus musculus


Alignment Length:196 Identity:72/196 - (36%)
Similarity:99/196 - (50%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFD----SQTLEVVLDPEFDNE------DWDCA 67
            |||.||.|::|:||.|.|..:|||||||||||...    .|.|:::||.|.|.|      ..|..
Mouse     8 SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLI 72

  Fly    68 EE--KKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYC 130
            |:  :.|||:||||||::.|||..|..||::||||.||||:|:.|.:||:|              
Mouse    73 EQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIG-------------- 123

  Fly   131 PSCNNVYIPLPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPP----VEKYIPRIYGFQLHKKALMP 191
                   ||    |:..|.:....|.|             |    .|..:|:::| ::|.:.|..
Mouse   124 -------IP----GLQSGCLSPRPFRH-------------PRRGHGETLLPQVHG-RVHTQVLQT 163

  Fly   192 P 192
            |
Mouse   164 P 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 69/185 (37%)
Csnk2bNP_001290405.1 CK_II_beta 8..>129 CDD:198153 62/145 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 1 1.010 - - QHG53662
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.