DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13590 and CG33795

DIOPT Version :10

Sequence 1:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:174 Identity:63/174 - (36%)
Similarity:105/174 - (60%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVEPAR 68
            |:.:..|:.|:.:.......| |:||.:|:|.|:|||.::.|||||.:|.:|..|.|.|...|..
  Fly     6 KIVVILVTFLLTWRLSYSVTY-KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTN 69

  Fly    69 NISVHFKTMKKANGYKPFLFDYTFDACEFMRRRNQPVAKIIWYMIRNVSTINHTCPYEGLQMLSD 133
            ::.:.::.:|:.|||||:|:....|.|.|:|:....:.|:|:.:.:..|.||||||:.|..::..
  Fly    70 DVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRG 134

  Fly   134 FH-KVDI-PVPLPSGDYLLMVDWLFDGKTQFATNVYFTFIEDLL 175
            .: :.:| .:|.|||.|:|.::|.|..|.|..||:.:.|||:||
  Fly   135 MYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13590NP_611919.1 DM8 83..171 CDD:214778 31/89 (35%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 27/75 (36%)

Return to query results.
Submit another query.