DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and LOC5667812

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_001688222.2 Gene:LOC5667812 / 5667812 VectorBaseID:AGAMI1_006481 Length:194 Species:Anopheles gambiae


Alignment Length:165 Identity:34/165 - (20%)
Similarity:60/165 - (36%) Gaps:49/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CRLKAYSRTKT-SLNINATFIEPAKNIYLHMKMMKKA--------------NGYKPFLFDYTFDA 94
            |:..|.....| :||...|||.  :.:.:.|::|::.              :|....|...|.|.
Mosquito    35 CKFNARIINLTCTLNKPNTFIN--QTVSMEMEIMREVKDVKLAAAYYVVSESGDSSRLVQRTVDL 97

  Fly    95 CEFMRRRNQP-FAKIVWNMIKNVSTVNH---TCP--------YEGLQMLSDFHHIDVPVPLPSGD 147
            |.::|..|:. ..|::::.:|...  ||   .||        ...|::.|    :.:|..:|...
Mosquito    98 CSYVRHPNRDRLVKVIFDRLKEKG--NHFVTKCPIPRNEKFYIRNLRLTS----VQIPGFIPESS 156

  Fly   148 YLLLLDWIFD--------FKPQFATNVYFTFVEGM 174
            :      ||:        |:|......|...|..|
Mosquito   157 F------IFENIYQIGALFEPAVEIRYYGKLVRVM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 21/107 (20%)
LOC5667812XP_001688222.2 None

Return to query results.
Submit another query.