DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG14518

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:156 Identity:80/156 - (51%)
Similarity:115/156 - (73%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIYLHMKMMKKANGYKP 85
            :|.:.|||||||::||||||....|||:|.||.|..||::|..:.|..::.:..:::|:||||||
  Fly    21 DAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKP 85

  Fly    86 FLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFH--HIDVPVPLPSGDY 148
            :|:..:||.|:|:||||....:|||.:.|..||:||||||.|||.:.:|:  ...:|.|:|:|:|
  Fly    86 WLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEY 150

  Fly   149 LLLLDWIFDFKPQFATNVYFTFVEGM 174
            ||::||:|:.|||.||||||||||.:
  Fly   151 LLMIDWVFNKKPQAATNVYFTFVEDL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 48/89 (54%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 48/89 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108326at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.900

Return to query results.
Submit another query.