powered by:
Protein Alignment CG13589 and CG13250
DIOPT Version :9
Sequence 1: | NP_611918.2 |
Gene: | CG13589 / 37906 |
FlyBaseID: | FBgn0035011 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649245.1 |
Gene: | CG13250 / 40284 |
FlyBaseID: | FBgn0037013 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 18/37 - (48%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 AKMTNAVCKSYNKSWVVVHYCRLKA---YSRTKTSLN 58
:::.|||.....:|......|.|.| |:.|:.:||
Fly 116 SRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALN 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13589 | NP_611918.2 |
DM8 |
83..171 |
CDD:214778 |
|
CG13250 | NP_649245.1 |
DM8 |
95..181 |
CDD:214778 |
11/37 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45472628 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.