DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33632

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:155 Identity:50/155 - (32%)
Similarity:84/155 - (54%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFL 87
            |.:.||..|::.:|.:.:..||.|::.:|:...:::....:: |...|.:...:.|:.|||||||
  Fly    25 LVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPFL 89

  Fly    88 FDYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPYEGLQMLSD--FHHIDVP----VPLPS 145
            ::.|.|.|.|::.|| .|.|...:|:.|:.|.:||||||....:|.:  :|.|:..    :|.|.
  Fly    90 YNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFPE 154

  Fly   146 GDYLLLLDWIFDFKPQFATNVYFTF 170
            |:|.|.:.||.....:..|..||.|
  Fly   155 GNYKLEVHWIAYDIDRAITTFYFAF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 36/95 (38%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472547
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.