DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33919

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:152 Identity:47/152 - (30%)
Similarity:73/152 - (48%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVILGFLVCGEAP----LAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKN 69
            |:.|:||....|:..    :.|:....| ..|::.|....|.:||.:.....:|::...|.|..|
  Fly     4 VLVVLLGCCFIGQLTNTQLVYKLKKIEC-LVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHN 67

  Fly    70 IYLHMKMMKK--ANGYKPFLFDYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPYEGLQML 131
            ..:.|::..|  :|.|||||.|.....||.:.||| .|:..|:|.:.|..:.|||:||:.|..:.
  Fly    68 PIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIA 132

  Fly   132 SD-FHHIDVPVPLPSGDYLLLL 152
            .| |....:..|.|.|.|.:.|
  Fly   133 RDGFLDTSLLPPFPQGFYQVSL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 28/72 (39%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.