DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33640

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:24/151 - (15%)
Similarity:56/151 - (37%) Gaps:36/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HYCRLKAYSR-TKTSLNINATFIE------PAKNIYLHMKMMKKANGYKPFLF----------DY 90
            |..||..:|. ...||..:..|::      ..::::|....:.:.:|.:.:|.          |.
  Fly     4 HKLRLLVFSSLINCSLCAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDL 68

  Fly    91 TFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQML----SDFHHIDVPVPLPSGDYLLL 151
            |..:...:.|..:|..::....:...|.:|:....:.::||    :.|.:.....||        
  Fly    69 TLTSSMDITRPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPL-------- 125

  Fly   152 LDWIFDFKPQFATNVYFTFVE 172
                   ||.|..:::..:::
  Fly   126 -------KPNFNYSLHRAYID 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 15/101 (15%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 12/82 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.