DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33923

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:154 Identity:49/154 - (31%)
Similarity:87/154 - (56%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFLFD 89
            :..|..|.:.:..:....||.|||.|||...|::....:| |...|.:::.::::.|||||||::
  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89

  Fly    90 YTFDACEFMR-RRNQPFAKIVWNMIKNVSTVNHTCPYEG---LQMLSDFHHIDVPV----PLPSG 146
            .|.|||:|.: :::.|.|:.:::..|:.|.:||:|||:.   ::.| ...|::..|    |:|.|
  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKL-PISHVNTQVTKVLPVPHG 153

  Fly   147 DYLLLLDW-IFDFKPQFATNVYFT 169
            |||...:| .:|.. :...:||.|
  Fly   154 DYLFHSNWYAYDIN-RAIVDVYAT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 33/96 (34%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472417
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.