DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33725

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:170 Identity:85/170 - (50%)
Similarity:113/170 - (66%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVILGFLV--CGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIY 71
            ::.|.:|.||  ..:|.:.|.||..|.|.|:||.|.|.|||||.||.|..||.|.|.:.||.||.
  Fly     9 ILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNII 73

  Fly    72 LHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFH- 135
            :|:|:.|||||:||:|.|...|||.|:|....||.:|::::.|:.||:||||||.|||::.||: 
  Fly    74 VHVKLFKKANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYL 138

  Fly   136 -HIDVPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVEGM 174
             ...:.:|.|||||||.|.||||.:|||.|||.|.:.|.:
  Fly   139 RPEKLKLPFPSGDYLLSLIWIFDKRPQFDTNVSFVYAEDL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 46/89 (52%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 39/79 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.