DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and dls

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:73/153 - (47%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFLFDYT 91
            ||..|.|||..::....||:||.:||...::|.|...: |..:..:.::..:..:||||||:|.:
  Fly    24 TNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLYDLS 88

  Fly    92 FDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDVP--------------VP 142
            :|.|:||:.:.....|..:...:..:.:||||||:        |.:.|.              :.
  Fly    89 YDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYD--------HDLIVDKLFTGNLEEEFGRFII 145

  Fly   143 LPSGDYLLLLDWIFDFKPQFATN 165
            :|:|||.:..||        |||
  Fly   146 IPNGDYAIYTDW--------ATN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 28/97 (29%)
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 24/87 (28%)

Return to query results.
Submit another query.