DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33690

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:73/153 - (47%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFLFDYT 91
            ||..|.|||..::....||:||.:||...::|.|...: |..:..:.::..:..:||||||:|.:
  Fly    24 TNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLYDLS 88

  Fly    92 FDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDVP--------------VP 142
            :|.|:||:.:.....|..:...:..:.:||||||:        |.:.|.              :.
  Fly    89 YDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYD--------HDLIVDKLFTGNLEEEFGRFII 145

  Fly   143 LPSGDYLLLLDWIFDFKPQFATN 165
            :|:|||.:..||        |||
  Fly   146 IPNGDYAIYTDW--------ATN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 28/97 (29%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472404
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.