DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33769

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:130 Identity:26/130 - (20%)
Similarity:48/130 - (36%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LKAYSRTKTSLNINATFIEPAKNIYLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWN 111
            |||:    .|.....|..:|.:::|.|               |..:  |..::...:...:..:.
  Fly    67 LKAH----LSFEFRLTKAKPYQSVYQH---------------DMNY--CALIKGSQESIYRRWFT 110

  Fly   112 MIKNVSTVNHTCPY-EGLQMLSDFHHID---VPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVE 172
            .:..|.....:||. ||...|..: .:|   ||..|..|||.:...:.:.   :|..::|...:|
  Fly   111 SMLKVGNFATSCPIREGYYYLHGW-TLDANNVPSFLYLGDYRISGSFYYG---RFKKHLYNPLLE 171

  Fly   173  172
              Fly   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 17/91 (19%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.