DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33700

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:90/167 - (53%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFI------EPAKN 69
            :::....|.|:   .::.|.:|:|::.:......|.:|...|     .:.|.::      .|.|:
  Fly    12 TLLWSIFVAGD---FQLQNVICESFDNAITNFSRCEMKFIRR-----GVAAFYMVWKLYNVPIKS 68

  Fly    70 IYLHMKMMKKANGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSD 133
            :.:::.:.||:|||:||||:.|.|.|.:||. |..|...::..:....|.:||:|||:...::::
  Fly    69 VDINVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINE 133

  Fly   134 FHH--IDV-PVPLPSGDYLLLLDWIFDFKPQFATNVY 167
            |.:  .|: .:|:|:|||::.:...||.:.:.:..:|
  Fly   134 FIYKKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKIY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 28/89 (31%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472508
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.