DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33758

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:149 Identity:38/149 - (25%)
Similarity:80/149 - (53%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIYLHMKMMKKANGYKPFLFD 89
            ||..:..|.::::.:.....|:|||.||.:.|:::.....:|...|::.::..|:|||::|||::
  Fly    19 AKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIRLEFFKRANGWRPFLYN 83

  Fly    90 YTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGL--QMLS------DFHHIDVPVPLPSG 146
            :|.:.|:|:.|.|.....|.:..::.....|::||::.:  ::|.      |.:::....|:.:|
  Fly    84 FTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDINNLRNRFPIETG 148

  Fly   147 DYLLLLDWIFDFKPQFATN 165
            :|.|.|.:|...|.....|
  Fly   149 EYALQLTFIAKNKAALTIN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 22/91 (24%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.