DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33928

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:165 Identity:47/165 - (28%)
Similarity:77/165 - (46%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYK 84
            |:...:.||..|.|.:|.:....||.|||.:||...|::.....: |..:..:::.:.|::||..
  Fly    23 ESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLM 87

  Fly    85 PFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDVP--------- 140
            ||..::|||.|:.:.....|....::.:.|..|.:||:|||.        |.|.|.         
  Fly    88 PFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYT--------HDIIVDKLPTHFVNQ 144

  Fly   141 -----VPLPSGDYLLLLDWIFDFKPQFATNVYFTF 170
                 ||||.|||:...:|..:.|.:....|:|:|
  Fly   145 QFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 29/102 (28%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472313
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.