DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33784

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:152 Identity:49/152 - (32%)
Similarity:76/152 - (50%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMK 75
            |::..|:.....|.|..|..|..|.||:..:..|.||...|....||::|...: |.|:....:.
  Fly    14 VVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLT 78

  Fly    76 MMKKANGYKPFLFDYTFDACEFMR-RRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDV 139
            :.::.:||:||||:.|.|.|.|:: |:..|||.:|::.||:.|.:|||||:.        |.|.|
  Fly    79 LFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFN--------HDIIV 135

  Fly   140 -----------PVPLPSGDYLL 150
                       ..|:|:|.|.|
  Fly   136 NQMVLNDDMISKAPVPNGFYKL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 30/80 (38%)
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472287
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.