DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33792

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:82/208 - (39%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVILGFLVC-------GEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEP 66
            |..|.||.|:|       ......|:....|.: |.::.....|.||..:.|::.||::....|.
  Fly     8 VSCVYLGVLLCLPNTIFYSNGYFFKIRKTECIA-NGAYFSNVSCILKPVNWTRSVLNMDGDIKEA 71

  Fly    67 AKNIYLHMKMMKK--ANGYKPFLFDYTFDACEFMRRRNQP--FAKIVWNMIKNVSTVNHTCPY-- 125
            ..:|.:.:::..|  :|.||||...:.||.|:.::.:.|.  ..|...:.:...:.|||:|||  
  Fly    72 LTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRV 136

  Fly   126 ---------------------EGLQMLSDFHHIDVPVP-LPSGDYLLLLDWIFDFKPQFATN--- 165
                                 :|..:..:|...:|.:| ||..||.:    .|:|.   ..|   
  Fly   137 SLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKI----AFNFS---GANPGI 194

  Fly   166 ------VYFTFVE 172
                  :||..:|
  Fly   195 HLGLVLIYFEILE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 28/122 (23%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.