DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33783

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:132 Identity:45/132 - (34%)
Similarity:71/132 - (53%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFLFDY 90
            :.|..|..|.||:..:..|.||...|....|.::|...: |..:....:.:.::.|||:|||::.
  Fly    10 VVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSLYRRFNGYRPFLYNM 74

  Fly    91 TFDACEFMR-RRNQPFAKIVWNMIKNVSTVNHTCPYE-----GLQMLSDFHHIDVPVPLPSGDYL 149
            |.|.|.|.: |:..||..:|::.|||.|.|||:||:.     ...:|:|  ::.|.||.|||.|.
  Fly    75 TVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLND--NMIVKVPFPSGFYK 137

  Fly   150 LL 151
            |:
  Fly   138 LM 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 31/75 (41%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472495
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.