DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33702

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:144 Identity:40/144 - (27%)
Similarity:66/144 - (45%) Gaps:25/144 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLN--INATFIEPAKNIYLHMKMMKKANGYKPFLF 88
            :.||..|.|.:..:.||..|.||...|:...:|  |...:.:|...|..::.:.:|:|.|:.||.
  Fly    25 RFTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPINKIEFNLSIFRKSNMYRLFLV 89

  Fly    89 DYTFDACEFMRRRNQ-PFAKIVWNMIKNVSTVNHTCPY--------------EGLQMLSDFHHID 138
            ::|.|.|.:|||..| |...:..:.:...:..||:|||              :.|:.|..|    
  Fly    90 NHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLLSF---- 150

  Fly   139 VPVPLPSGDYLLLL 152
                ||.|:|.|::
  Fly   151 ----LPVGEYKLVV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 24/85 (28%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472430
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.