DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33768

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:125 Identity:29/125 - (23%)
Similarity:46/125 - (36%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLKAYSRTKTSLNINATFIEPAKNIYL--------------HMKMMKKANGYKPF--LFDYTFDA 94
            |::.....|....:|.|.:.  ..||.              |:.:..:.:..|.|  |.....|.
  Fly    25 RVQCEKNAKFFATLNVTSVN--STIYADIELLQALKAGFRGHVDVQLRLSNAKKFQSLVQADTDY 87

  Fly    95 CEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHID---VPVPLPSGDYLL 150
            ||.:.. ::..|.:.:.::.|| |.....||...........|::   ||..|.||||||
  Fly    88 CELLSTLKDSLFRRWIKSVSKN-SNFMENCPVPAGHYYLKGWHVEMGLVPSYLLSGDYLL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 22/74 (30%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.