DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33631

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:106 Identity:24/106 - (22%)
Similarity:36/106 - (33%) Gaps:22/106 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NIYLHMKMMKKANGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLS 132
            ||.:.::...:.| :...|.....|.|.|... |..|..|..               .:....||
  Fly    85 NIKIRVRPTGRTN-FVTLLQMRDLDLCGFFTEFRKNPMMKYF---------------LQSEMQLS 133

  Fly   133 DFHHIDVPVPLPSGDYLLLLDWIFDFKPQFATN-VYFTFVE 172
            |.    :..|:..|:|.:....:.|..||...| :|..|||
  Fly   134 DI----IVCPVRVGNYSVKNVSVKDIYPQVLQNGIYKFFVE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 18/89 (20%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 21/101 (21%)

Return to query results.
Submit another query.