DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33703

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:176 Identity:40/176 - (22%)
Similarity:80/176 - (45%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVILGFLV---CGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFI--EPAK 68
            ::|::|..|:   |.:..:.:::...|:|.:.|:.....|::......:.:|.::..|:  :|..
  Fly     5 LLSLVLPLLIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPID 69

  Fly    69 NIYLHMKMMKKANGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLS 132
            :|.|::.:.:.|...:....:.|.|.|.|.|: ....|...:...:..:|.:|.|||   ||...
  Fly    70 DIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCP---LQQNI 131

  Fly   133 DFHHIDV------PVPLPSGDYL------LLLDWIFDFKPQFATNV 166
            .|:...|      .:|:|:|.|:      |:..|..|.| .:||.|
  Fly   132 TFNGFSVDENTIKEIPIPNGVYMFHLRSSLMKKWRTDVK-VYATRV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 26/97 (27%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.