DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33137

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:136 Identity:37/136 - (27%)
Similarity:64/136 - (47%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KMTNAVCK-----SYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIYLHMKMMKK--ANGY 83
            |:.|..|.     |.|.|      |.::|.:..|....::...:.|..||.:..:::||  :|.:
  Fly    15 KLKNIECSTVPGFSANAS------CHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKF 73

  Fly    84 KPFLFDYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPYEGLQM-----LSDFHHIDVPVP 142
            :|||.|...:.|:.:.||: .|:..|:..:.:..|..||:|||.|..|     |::.:   :|..
  Fly    74 QPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESY---LPNV 135

  Fly   143 LPSGDY 148
            .|.|.|
  Fly   136 FPLGFY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 22/72 (31%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.