DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG13193

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:157 Identity:34/157 - (21%)
Similarity:59/157 - (37%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVILGFLVCGEAPLAKMTNA-------VCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEP 66
            ::.:.:..|..|....:|.||.       .|.|. :.|       |.|.......:::|.|....
  Fly    19 LIQIQISALRFGPTLRSKFTNISVECSKDYCSSI-RGW-------LTAKGELNLDIHLNRTLKNG 75

  Fly    67 AKNIYLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNV---STVNHTCP---- 124
            .:.....::::...:.|:. ||.|..|.|:.:|...|.....||  ::||   ..:...||    
  Fly    76 LRTTITLLQLIDGKDRYQT-LFSYDMDTCKTLRELLQSSLMKVW--LRNVFKYGNLADRCPIQPA 137

  Fly   125 -YEGLQMLSDFHHIDVPVPLPSGDYLL 150
             |:......:.|  .:|..||:|.|.|
  Fly   138 SYDVRNFQLENH--SIPGYLPAGFYRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 22/76 (29%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 22/77 (29%)

Return to query results.
Submit another query.