DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG13198

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:157 Identity:41/157 - (26%)
Similarity:76/157 - (48%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAKMTNAVCKSY--NKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKP 85
            |.|.||..|...  ::......||.||...|.:..|::..:..: |.:|:...::..::.:||:|
  Fly    24 LLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRP 88

  Fly    86 FLFDYTFDACEFMRRRNQ--PFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHID---VPVPLPS 145
            |::...||.|:.|..||.  .|.:.:::.|:..|..|.|||::...|..:...:|   :.:|:|:
  Fly    89 FMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPA 153

  Fly   146 GDYLLLLDWIFDFKPQFATNVYFTFVE 172
            |.|.|...:......:..|.|:|..:|
  Fly   154 GTYRLGFTFYAYGIARTLTQVFFEKIE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 26/92 (28%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.